Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human B-cell receptor-associated protein 29 (BCAP29)

This Recombinant Human B-cell receptor-associated protein 29 (BCAP29) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

B-cell receptor-associated protein 29, BCR-associated protein 29, Bap29

UniProt

Q9UHQ4

Expression Region

1-241

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLQWAAVATFLYAEIGLILIFCLPFIPPQRWQKIFSFNVWGKIATFWNKAFLTIIILLI VLFLDAVREVRKYSSVHTIEKSSTSRPDAYEHTQMKLFRSQRNLYISGFSLFFWLVLRRL VTLITQLAKELSNKGVLKTQAENTNKAAKKFMEENEKLKRILKSHGKDEECVLEAENKKL VEDQEKLKTELRKTSDALSKAQNDVMEMKMQSERLSKEYDQLLKEHSELQDRLERGNKKR L

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Catalase Assay Kit
EGQA0075 100 Tests

Catalase Assay Kit

Sign In for Pricing
View Details
Recombinant Human Transcription factor HIVEP3 (HIVEP3) , partial
MBS1405901-01 0.02 mg (E-Coli)

Recombinant Human Transcription factor HIVEP3 (HIVEP3) , partial

Sign In for Pricing
View Details
Recombinant Human Transcription factor HIVEP3 (HIVEP3) , partial
MBS1405901-02 0.02 mg (Yeast)

Recombinant Human Transcription factor HIVEP3 (HIVEP3) , partial

Sign In for Pricing
View Details
Recombinant Human Transcription factor HIVEP3 (HIVEP3) , partial
MBS1405901-03 0.1 mg (E-Coli)

Recombinant Human Transcription factor HIVEP3 (HIVEP3) , partial

Sign In for Pricing
View Details
Recombinant Human Transcription factor HIVEP3 (HIVEP3) , partial
MBS1405901-04 0.1 mg (Yeast)

Recombinant Human Transcription factor HIVEP3 (HIVEP3) , partial

Sign In for Pricing
View Details
Recombinant Human Transcription factor HIVEP3 (HIVEP3) , partial
MBS1405901-05 0.02 mg (Baculovirus)

Recombinant Human Transcription factor HIVEP3 (HIVEP3) , partial

Sign In for Pricing
View Details