Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human B-cell receptor-associated protein 29 (BCAP29)

This Recombinant Human B-cell receptor-associated protein 29 (BCAP29) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

B-cell receptor-associated protein 29, BCR-associated protein 29, Bap29

UniProt

Q9UHQ4

Expression Region

1-241

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLQWAAVATFLYAEIGLILIFCLPFIPPQRWQKIFSFNVWGKIATFWNKAFLTIIILLI VLFLDAVREVRKYSSVHTIEKSSTSRPDAYEHTQMKLFRSQRNLYISGFSLFFWLVLRRL VTLITQLAKELSNKGVLKTQAENTNKAAKKFMEENEKLKRILKSHGKDEECVLEAENKKL VEDQEKLKTELRKTSDALSKAQNDVMEMKMQSERLSKEYDQLLKEHSELQDRLERGNKKR L

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat PLBD2 Protein, His, Yeast-100ug
QP7660-ye-100ug 100ug

Recombinant Rat PLBD2 Protein, His, Yeast-100ug

Sign In for Pricing
View Details
UBTF Antibody / UBF1 / Upstream binding factor 1
FY13331 100 µL

UBTF Antibody / UBF1 / Upstream binding factor 1

Sign In for Pricing
View Details
XFD750 Anti-dog/ chicken/ rabbit/ guinea pig/ horse/ cow/ mouse/ rat/ pig/ non-human primates/ human CD79a Antibody *HM47*
107901B0-AAT 100 Tests

XFD750 Anti-dog/ chicken/ rabbit/ guinea pig/ horse/ cow/ mouse/ rat/ pig/ non-human primates/ human CD79a Antibody *HM47*

Sign In for Pricing
View Details
VPS28 Antibody
orb1255663 100 µL

VPS28 Antibody

Sign In for Pricing
View Details
ACD Antibody
orb1335135 100 µg

ACD Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal RASAL2 Antibody [Alexa Fluor 647]
NBP1-19150AF647 0.1 mL

Rabbit Polyclonal RASAL2 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details