Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Peroxisomal membrane protein 11C (Pex11g)

This Recombinant Mouse Peroxisomal membrane protein 11C (Pex11g) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

Peroxisomal membrane protein 11C, Peroxin-11C, Peroxisomal biogenesis factor 11C, Protein PEX11 homolog gamma, PEX11-gamma

UniProt

Q6P6M5

Expression Region

1-241

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALLNRLASALESHRVRDRLIRTLGYCCQLIGGVLVEQCPNRSEVGRRLLVVSAQFNHCR TVLRLFDDLAMFVYTKQYGLGTKEEDIFIRWLSVLSNVTDQLYYPCEHIAWAADAKVLRV DSAWWWTLNTALWTLSLLLGAVKALWTMLKLRQKLRSPTGTSASQLPRSKRRAMEARICS EVLTLLSNLADLANAVHWLPRGVLWAGRFPPWLVGLMGTISSILSTCQAVRAGRQAEADS P

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Neuregulin-1/NRG1-β1 Protein (EGF Domain, Fc Tag)
PKSH031068-01 100 µg

Recombinant Human Neuregulin-1/NRG1-β1 Protein (EGF Domain, Fc Tag)

Sign In for Pricing
View Details
Recombinant Human Neuregulin-1/NRG1-β1 Protein (EGF Domain, Fc Tag)
PKSH031068-02 1 mg

Recombinant Human Neuregulin-1/NRG1-β1 Protein (EGF Domain, Fc Tag)

Sign In for Pricing
View Details
Mouse Catenin Beta 1 (CTNNb1) ELISA Kit
RD-CTNNb1-Mu-01 96 Tests

Mouse Catenin Beta 1 (CTNNb1) ELISA Kit

Sign In for Pricing
View Details
Mouse Catenin Beta 1 (CTNNb1) ELISA Kit
RD-CTNNb1-Mu-02 48 Tests

Mouse Catenin Beta 1 (CTNNb1) ELISA Kit

Sign In for Pricing
View Details
Tissue Total RNA, Colon
CR559843 5 µg

Tissue Total RNA, Colon

Sign In for Pricing
View Details
Tianeptine Metabolite MC5-d4 Sodium Salt
TRC-T436812-1MG 1 mg

Tianeptine Metabolite MC5-d4 Sodium Salt

Sign In for Pricing
View Details