Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Peroxisomal membrane protein 11C (Pex11g)

This Recombinant Mouse Peroxisomal membrane protein 11C (Pex11g) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

Peroxisomal membrane protein 11C, Peroxin-11C, Peroxisomal biogenesis factor 11C, Protein PEX11 homolog gamma, PEX11-gamma

UniProt

Q6P6M5

Expression Region

1-241

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALLNRLASALESHRVRDRLIRTLGYCCQLIGGVLVEQCPNRSEVGRRLLVVSAQFNHCR TVLRLFDDLAMFVYTKQYGLGTKEEDIFIRWLSVLSNVTDQLYYPCEHIAWAADAKVLRV DSAWWWTLNTALWTLSLLLGAVKALWTMLKLRQKLRSPTGTSASQLPRSKRRAMEARICS EVLTLLSNLADLANAVHWLPRGVLWAGRFPPWLVGLMGTISSILSTCQAVRAGRQAEADS P

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem161b Mouse Gene Knockout Kit (CRISPR)
KN517745 1 Kit

Tmem161b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FITC Conjugated Goat Affinity Purified Antibody to Rabbit IgG, Fc Specific
FAF-451-1 1 mL

FITC Conjugated Goat Affinity Purified Antibody to Rabbit IgG, Fc Specific

Sign In for Pricing
View Details
Srsf2 Mouse Gene Knockout Kit (CRISPR)
KN516744 1 Kit

Srsf2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cleaved+pro Caspase-3 Recombinant Rabbit monoclonal Antibody
HA750159 100 µL

Cleaved+pro Caspase-3 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (C3e/2858R), 0.2mg/mL
BNUB2858-500 1x 500 µL

CD3e (T-Cell Marker) (C3e/2858R), 0.2mg/mL

Sign In for Pricing
View Details
H-FABP Recombinant Rabbit monoclonal Antibody
HA725177 100 µL

H-FABP Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details