Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Copper transport protein CTR3 (CTR3)

This Recombinant Saccharomyces cerevisiae Copper transport protein CTR3 (CTR3) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

Copper transport protein CTR3, Copper transporter 3

UniProt

Q06686

Expression Region

1-241

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNMGGSSSTAAKKATCKISMLWNWYTIDTCFIARSWRNDTKGKFAGSCIGCFALVVVAQW LTRFSRQFDVELLKRQKIKHLASYSPEEYVVKCGEEDAKSDIEELQGFYNEPSWKTTLIS LQKSFIYSFYVWGPRRLNEPEDDLLKKVLSCCTLITPVDLYPTFLDHMIRVTIFVLQWGL SYIIMLLFMYYNGYIIISCLIGAIVGRFIFCYEPLGSLGANGSAQGTVSYDKESDDRKCC L

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERCC1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H5]
TA501140BM 100 µL

ERCC1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H5]

Sign In for Pricing
View Details
1-Heptyne
TRC-H288200-50G 50 g

1-Heptyne

Sign In for Pricing
View Details
PP1C gamma (PPP1CC) Rabbit Polyclonal Antibody
TA367202 100 µL

PP1C gamma (PPP1CC) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometrium
CS704377 5x 5 µm

Tissue FFPE Sections, Endometrium

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: left
CS804044 5x 5 µm

Tissue FFPE Sections, Ovary: left

Sign In for Pricing
View Details
YAP1 Mouse Monoclonal Antibody [Clone ID: OTI4B2]
CF813312 100 µg

YAP1 Mouse Monoclonal Antibody [Clone ID: OTI4B2]

Sign In for Pricing
View Details