Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Copper transport protein CTR3 (CTR3)

This Recombinant Saccharomyces cerevisiae Copper transport protein CTR3 (CTR3) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

Copper transport protein CTR3, Copper transporter 3

UniProt

Q06686

Expression Region

1-241

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNMGGSSSTAAKKATCKISMLWNWYTIDTCFIARSWRNDTKGKFAGSCIGCFALVVVAQW LTRFSRQFDVELLKRQKIKHLASYSPEEYVVKCGEEDAKSDIEELQGFYNEPSWKTTLIS LQKSFIYSFYVWGPRRLNEPEDDLLKKVLSCCTLITPVDLYPTFLDHMIRVTIFVLQWGL SYIIMLLFMYYNGYIIISCLIGAIVGRFIFCYEPLGSLGANGSAQGTVSYDKESDDRKCC L

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

10,11-Dehydroxy Limaprost (>85%) Sodium Salt
TRC-D230525-1MG 1 mg

10,11-Dehydroxy Limaprost (>85%) Sodium Salt

Sign In for Pricing
View Details
7-Ethyl-10-(4-N-aminopentanoic acid)-1-piperidino)carbonyloxycamptothecin-d3
TRC-E898902-1MG 1 mg

7-Ethyl-10-(4-N-aminopentanoic acid)-1-piperidino)carbonyloxycamptothecin-d3

Sign In for Pricing
View Details
SPC25 Mouse Monoclonal Antibody [Clone ID: OTI5E7]
CF806565 100 µg

SPC25 Mouse Monoclonal Antibody [Clone ID: OTI5E7]

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF740 conjugate, 0.1mg/mL
BNC740676-100 1x 100 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Multifunctional operation table BOPT-502
BOPT-502 1 Unit

Multifunctional operation table BOPT-502

Sign In for Pricing
View Details
P21WAF1 (Tumor Suppressor Protein) (AC8), CF568 conjugate, 0.1mg/mL
BNC682378-100 1x 100 µL

P21WAF1 (Tumor Suppressor Protein) (AC8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details