Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ypjB (ypjB)

This Recombinant Bacillus subtilis Uncharacterized protein ypjB (ypjB) spans the amino acid sequence from region 23-264.

Product Specifications

Product Name Alternative

Uncharacterized protein ypjB

UniProt

P54393

Expression Region

23-264

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AERGSLEELNDLSDTVFQMTRQAKYEEALQVLEYFEKTLKSAEKKQQDPMLTGAQIRQIT LGYNDMVRSLKQADTSDTQKLRAAAQFRMLMDAVDNRSDPLWGSLEKPIMEAFTELKRDV QKNGSTSFHEKWNEFISLYDLIYPSLTIDVSEDQLETVGKHIDVIEQEEFQQMTESTKLE RLSLLQHDLKNVFDRVEEDDADPSLLWVIITTGSIIITALTYVGYRKYKAEKNKLKKRDY PK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EPHA2 Monoclonal Antibody
TA399600 100 µg

EPHA2 Monoclonal Antibody

Sign In for Pricing
View Details
Rat Aminolevulinate Delta Dehydratase (ALAD) ELISA Kit
MBS2021749-01 24 Strip Well

Rat Aminolevulinate Delta Dehydratase (ALAD) ELISA Kit

Sign In for Pricing
View Details
Rat Aminolevulinate Delta Dehydratase (ALAD) ELISA Kit
MBS2021749-02 48 Well

Rat Aminolevulinate Delta Dehydratase (ALAD) ELISA Kit

Sign In for Pricing
View Details
Rat Aminolevulinate Delta Dehydratase (ALAD) ELISA Kit
MBS2021749-03 96 Well

Rat Aminolevulinate Delta Dehydratase (ALAD) ELISA Kit

Sign In for Pricing
View Details
Rat Aminolevulinate Delta Dehydratase (ALAD) ELISA Kit
MBS2021749-04 5x 96 Well

Rat Aminolevulinate Delta Dehydratase (ALAD) ELISA Kit

Sign In for Pricing
View Details
Rat Aminolevulinate Delta Dehydratase (ALAD) ELISA Kit
MBS2021749-05 10x 96 Well

Rat Aminolevulinate Delta Dehydratase (ALAD) ELISA Kit

Sign In for Pricing
View Details