Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ypjB (ypjB)

This Recombinant Bacillus subtilis Uncharacterized protein ypjB (ypjB) spans the amino acid sequence from region 23-264.

Product Specifications

Product Name Alternative

Uncharacterized protein ypjB

UniProt

P54393

Expression Region

23-264

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AERGSLEELNDLSDTVFQMTRQAKYEEALQVLEYFEKTLKSAEKKQQDPMLTGAQIRQIT LGYNDMVRSLKQADTSDTQKLRAAAQFRMLMDAVDNRSDPLWGSLEKPIMEAFTELKRDV QKNGSTSFHEKWNEFISLYDLIYPSLTIDVSEDQLETVGKHIDVIEQEEFQQMTESTKLE RLSLLQHDLKNVFDRVEEDDADPSLLWVIITTGSIIITALTYVGYRKYKAEKNKLKKRDY PK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLEC2D Antibody
orb1561836-01 50 µL

CLEC2D Antibody

Sign In for Pricing
View Details
CLEC2D Antibody
orb1561836-02 100 µL

CLEC2D Antibody

Sign In for Pricing
View Details
CLEC2D Antibody
orb1561836-03 200 µL

CLEC2D Antibody

Sign In for Pricing
View Details
Ulk1 ORF Vector (Mouse) (pORF)
ORF061028 1.0 µg DNA

Ulk1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Guinea Pig Olfactory receptor 5H2 (OR5H2) ELISA kit
GTR10438300 96 Well

Guinea Pig Olfactory receptor 5H2 (OR5H2) ELISA kit

Sign In for Pricing
View Details
Histone H2A (Acetyl Lys15) Rabbit Polyclonal Antibody
E12-268 100 µg -100 µL

Histone H2A (Acetyl Lys15) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details