Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi C Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

This Recombinant Salmonella paratyphi C Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) spans the amino acid sequence from region 1-242.

Product Specifications

Product Name Alternative

Monofunctional biosynthetic peptidoglycan transglycosylase, Monofunctional TGase, EC= 2.4.2.-

UniProt

C0PZM1

Expression Region

1-242

Origin

Salmonella paratyphi C (strain RKS4594)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKRRIAPLTFLRRLLLRILAALAVFWGGGIALFSVVPVPFSAVMAERQISAWLGGEFGY VAHSDWVSMADISPWMGLAVIAAEDQKFPEHWGFDVPAIEKALAHNERNESRIRGASTLS QQTAKNLFLWDGRSWLRKGLEAGLTLGIETVWSKKRILTVYLNIAEFGDGIFGVEAAAQR YFHKPASRLSVSEAALLAAVLPNPLRYKANAPSGYVRSRQAWIMRQMRQLGGESFMTRNQ LN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (TV-1), CF640R conjugate, 0.1mg/mL
BNC400029-500 1x 500 µL

Fibronectin (TV-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF405S conjugate, 0.1mg/mL
BNC040193-100 1x 100 µL

CD86 (BU63), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF488A conjugate, 0.1mg/mL
BNC880175-500 1x 500 µL

CD46 (122.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (8C8), CF740 conjugate, 0.1mg/mL
BNC740005-500 1x 500 µL

Bcl-2 (8C8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD79a (JCB117 + HM47/A9), CF594 conjugate, 0.1mg/mL
BNC940828-100 1x 100 µL

CD79a (JCB117 + HM47/A9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytochrome C (CYCS/1010), CF647 conjugate, 0.1mg/mL
BNC471010-100 1x 100 µL

Cytochrome C (CYCS/1010), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details