Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe Uncharacterized membrane protein C18H10.18c (SPBC18H10.18c)

This Recombinant Schizosaccharomyces pombe Uncharacterized membrane protein C18H10.18c (SPBC18H10.18c) spans the amino acid sequence from region 1-242.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein C18H10.18c

UniProt

O60148

Expression Region

1-242

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPDEKLPQYNEVWNDLEKGCLHSCPSYSVNNHVNNPIVKQNSTLTQPSLRKKNTMAAPAR LRKRSENVRLTQARYAIFHIFLPFILTLLLYHNFYNYFDQALADLNSVVKYVIETIVLIF TYVMTVIIVYFSFSLIKLAFEEAYVYAPSVAKANEGLAKHVAKTIAGLVKYVAKAIQGLA HIILSLLLFILGLEVIEQDEETGDVEMSSMRGQAITTEPASDNTMAEGTDCNTSKDVESG SS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

0.4cm Electroporation Cuvettes, pack of 20 pieces
72004-20 each

0.4cm Electroporation Cuvettes, pack of 20 pieces

Sign In for Pricing
View Details
C11orf21 (NM_001142946) Human Over-expression Lysate
LS029125 100 µg

C11orf21 (NM_001142946) Human Over-expression Lysate

Sign In for Pricing
View Details
GoldBand 3-color Low Range Protein Marker (2.7-40 kDa)
20344ES90 10x 250 μL

GoldBand 3-color Low Range Protein Marker (2.7-40 kDa)

Sign In for Pricing
View Details
S 863390
MBS5775900 Inquire

S 863390

Sign In for Pricing
View Details
DHDH (NM_014475) Human Untagged Clone
SC321734 10 µg

DHDH (NM_014475) Human Untagged Clone

Sign In for Pricing
View Details
Lentiviral human SNX32 shRNA (UAS) - Lentiviral human SNX32 shRNA (UAS) (100)
GTR15142566 1 Vial

Lentiviral human SNX32 shRNA (UAS) - Lentiviral human SNX32 shRNA (UAS) (100)

Sign In for Pricing
View Details