Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Transmembrane protein 174 (Tmem174)

This Recombinant Rat Transmembrane protein 174 (Tmem174) spans the amino acid sequence from region 1-243.

Product Specifications

Product Name Alternative

Transmembrane protein 174

UniProt

Q68FU0

Expression Region

1-243

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEQSSNRPEDFPLNVFSVTPYTPSTADIQVSDDDKAGATLLFSGIFLGLVGITFTVMGWI KYQGVSHFEWTQLLGPILLSVGVTFILISVCKFKMLSCQLCTDNEERVLDSDQTSGGQSF VFTGINQPITFHGATVVQYIPPPYGSQEPLGMNTTYLQPMMNPCGLVPSSGAVAATPSPP QYYTIYPQDNAAFVESEGFSPFVGAGHDRPSSDADQLEGTQMGEEERVCFSPPPYEEIYA LPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6a-Bromo Androstenedione
TRC-B679700-50MG 50 mg

6a-Bromo Androstenedione

Sign In for Pricing
View Details
HPD (NM_002150) Human Over-expression Lysate
LC419503 20 µg

HPD (NM_002150) Human Over-expression Lysate

Sign In for Pricing
View Details
Pygm Mouse Gene Knockout Kit (CRISPR)
KN514291 1 Kit

Pygm Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Elab Fluor® 488 Goat Anti-Rat IgG (H+L) Antibody[Poly1441]
AN00339L-01 50 Tests

Elab Fluor® 488 Goat Anti-Rat IgG (H+L) Antibody[Poly1441]

Sign In for Pricing
View Details
Elab Fluor® 488 Goat Anti-Rat IgG (H+L) Antibody[Poly1441]
AN00339L-02 100 Tests

Elab Fluor® 488 Goat Anti-Rat IgG (H+L) Antibody[Poly1441]

Sign In for Pricing
View Details
Elab Fluor® 488 Goat Anti-Rat IgG (H+L) Antibody[Poly1441]
AN00339L-03 2x 100 Tests

Elab Fluor® 488 Goat Anti-Rat IgG (H+L) Antibody[Poly1441]

Sign In for Pricing
View Details