Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 174 (TMEM174)

This Recombinant Human Transmembrane protein 174 (TMEM174) spans the amino acid sequence from region 1-243.

Product Specifications

Product Name Alternative

Transmembrane protein 174

UniProt

Q8WUU8

Expression Region

1-243

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEQGSGRLEDFPVNVFSVTPYTPSTADIQVSDDDKAGATLLFSGIFLGLVGITFTVMGWI KYQGVSHFEWTQLLGPVLLSVGVTFILIAVCKFKMLSCQLCKESEERVPDSEQTPGGPSF VFTGINQPITFHGATVVQYIPPPYGSPEPMGINTSYLQSVVSPCGLITSGGAAAAMSSPP QYYTIYPQDNSAFVVDEGCLSFTDGGNHRPNPDVDQLEETQLEEEACACFSPPPYEEIYS LPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NucView® 488 Caspase-3 Substrate, 1mM in 1X PBS
#10403-T 1x 10 µL

NucView® 488 Caspase-3 Substrate, 1mM in 1X PBS

Sign In for Pricing
View Details
STARD4 Polyclonal Antibody
E-AB-66635-01 60 µL

STARD4 Polyclonal Antibody

Sign In for Pricing
View Details
STARD4 Polyclonal Antibody
E-AB-66635-02 120 µL

STARD4 Polyclonal Antibody

Sign In for Pricing
View Details
STARD4 Polyclonal Antibody
E-AB-66635-03 200 µL

STARD4 Polyclonal Antibody

Sign In for Pricing
View Details
Sodium Chloride, 1kg
PC0914-1kg 1 Kg

Sodium Chloride, 1kg

Sign In for Pricing
View Details
Neo Heliopan AP Sodium Salt
TRC-N389945-1G 1 g

Neo Heliopan AP Sodium Salt

Sign In for Pricing
View Details