Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 174 (TMEM174)

This Recombinant Human Transmembrane protein 174 (TMEM174) spans the amino acid sequence from region 1-243.

Product Specifications

Product Name Alternative

Transmembrane protein 174

UniProt

Q8WUU8

Expression Region

1-243

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEQGSGRLEDFPVNVFSVTPYTPSTADIQVSDDDKAGATLLFSGIFLGLVGITFTVMGWI KYQGVSHFEWTQLLGPVLLSVGVTFILIAVCKFKMLSCQLCKESEERVPDSEQTPGGPSF VFTGINQPITFHGATVVQYIPPPYGSPEPMGINTSYLQSVVSPCGLITSGGAAAAMSSPP QYYTIYPQDNSAFVVDEGCLSFTDGGNHRPNPDVDQLEETQLEEEACACFSPPPYEEIYS LPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CXorf51B Antibody
KC-3149-01 50 μL

CXorf51B Antibody

Sign In for Pricing
View Details
CXorf51B Antibody
KC-3149-02 100 µL

CXorf51B Antibody

Sign In for Pricing
View Details
CXorf51B Antibody
KC-3149-03 1 mL

CXorf51B Antibody

Sign In for Pricing
View Details
rac-2-Hydroxy Nicotine
TRC-H949545-1MG 1 mg

rac-2-Hydroxy Nicotine

Sign In for Pricing
View Details
Cytokeratin 1 (Suprabasal Keratinocyte Marker) (LHK1), CF740 conjugate, 0.1mg/mL
BNC741660-500 1x 500 µL

Cytokeratin 1 (Suprabasal Keratinocyte Marker) (LHK1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ATPBD4 (DPH6) Human Gene Knockout Kit (CRISPR)
KN209471 1 Kit

ATPBD4 (DPH6) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details