Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 174 (Tmem174)

This Recombinant Mouse Transmembrane protein 174 (Tmem174) spans the amino acid sequence from region 1-243.

Product Specifications

Product Name Alternative

Transmembrane protein 174

UniProt

Q9DCX7

Expression Region

1-243

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEHSSNRPEDFPLNVFSVTPYTPSTADIQVSDDDKAGATLLFSGIFLGLVGITFTVMGWI KYQGVSHFEWTQLLGPILLSVGVTFILIAVCKFKMLSCQLCSDNEERVPDSDQTSGGQSF VFTGINQPITFHGATVVQYIPPPYGSQEPLGMNATYLQPMMNPCGLIPPSGAAAAAPSPP QYYTIYPQDNAAFVESEGFSPFVGTGYDRPDSDADQLEGTELEEEDCVCFSPPPYEEIYA LPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TFPI Adenovirus (Mouse)
46579054 1.0 mL

TFPI Adenovirus (Mouse)

Sign In for Pricing
View Details
IFNA16 Rabbit Polyclonal Antibody
TA351276 100 µL

IFNA16 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Svs3a 3'UTR Lenti-reporter-Luc Vector
45931086 1.0 µg

Svs3a 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Anti-CD138 antibody(DM45), Rabbit mAb
TA389236 100 µg

Anti-CD138 antibody(DM45), Rabbit mAb

Sign In for Pricing
View Details
Human Beta-glucuronidase ELISA Kit
MBS2880728-01 48 Well

Human Beta-glucuronidase ELISA Kit

Sign In for Pricing
View Details
Human Beta-glucuronidase ELISA Kit
MBS2880728-02 96 Well

Human Beta-glucuronidase ELISA Kit

Sign In for Pricing
View Details