Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 174 (Tmem174)

This Recombinant Mouse Transmembrane protein 174 (Tmem174) spans the amino acid sequence from region 1-243.

Product Specifications

Product Name Alternative

Transmembrane protein 174

UniProt

Q9DCX7

Expression Region

1-243

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEHSSNRPEDFPLNVFSVTPYTPSTADIQVSDDDKAGATLLFSGIFLGLVGITFTVMGWI KYQGVSHFEWTQLLGPILLSVGVTFILIAVCKFKMLSCQLCSDNEERVPDSDQTSGGQSF VFTGINQPITFHGATVVQYIPPPYGSQEPLGMNATYLQPMMNPCGLIPPSGAAAAAPSPP QYYTIYPQDNAAFVESEGFSPFVGTGYDRPDSDADQLEGTELEEEDCVCFSPPPYEEIYA LPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VU 0360172
TRC-V787600-100MG 100 mg

VU 0360172

Sign In for Pricing
View Details
Mouse Galectin-3 ELISA Kit (Colorimetric)
NBP2-67973 1 Kit

Mouse Galectin-3 ELISA Kit (Colorimetric)

Sign In for Pricing
View Details
H-Arg-Asn-Ile-Ala-Glu-Ile-Ile-Lys-Asp-Ile-OH
H-1016.0005 5.0mg

H-Arg-Asn-Ile-Ala-Glu-Ile-Ile-Lys-Asp-Ile-OH

Sign In for Pricing
View Details
Recombinant Human S100A4 Protein, His-SUMO, E.coli-1mg
QP6639-ec-1mg 1mg

Recombinant Human S100A4 Protein, His-SUMO, E.coli-1mg

Sign In for Pricing
View Details
GremLin 1 (GREM1) Human shRNA Plasmid Kit (Locus ID 26585)
TL312620 1 Kit

GremLin 1 (GREM1) Human shRNA Plasmid Kit (Locus ID 26585)

Sign In for Pricing
View Details
Bovine Rab GDP Dissociation Inhibitor Alpha (GDI1) ELISA Kit-Sandwich
EK12F52-01 48 Test

Bovine Rab GDP Dissociation Inhibitor Alpha (GDI1) ELISA Kit-Sandwich

Sign In for Pricing
View Details