Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 174 (Tmem174)

This Recombinant Mouse Transmembrane protein 174 (Tmem174) spans the amino acid sequence from region 1-243.

Product Specifications

Product Name Alternative

Transmembrane protein 174

UniProt

Q9DCX7

Expression Region

1-243

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEHSSNRPEDFPLNVFSVTPYTPSTADIQVSDDDKAGATLLFSGIFLGLVGITFTVMGWI KYQGVSHFEWTQLLGPILLSVGVTFILIAVCKFKMLSCQLCSDNEERVPDSDQTSGGQSF VFTGINQPITFHGATVVQYIPPPYGSQEPLGMNATYLQPMMNPCGLIPPSGAAAAAPSPP QYYTIYPQDNAAFVESEGFSPFVGTGYDRPDSDADQLEGTELEEEDCVCFSPPPYEEIYA LPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rno-miR-19a-5p miRNA Agomir
CMS0401-01 5 nmol

Rno-miR-19a-5p miRNA Agomir

Sign In for Pricing
View Details
Rno-miR-19a-5p miRNA Agomir
CMS0401-02 10 nmol

Rno-miR-19a-5p miRNA Agomir

Sign In for Pricing
View Details
Rno-miR-19a-5p miRNA Agomir
CMS0401-03 20 nmol

Rno-miR-19a-5p miRNA Agomir

Sign In for Pricing
View Details
IGLL1 CRISPRa sgRNA lentivector (set of three targets)(Human)
24689121 3x 1.0µg DNA

IGLL1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
CCDC28A, NT (CCDC28A, C6orf80, Coiled-coil domain-containing protein 28A, CCRL1AP) (MaxLight 650) discontinued
033316-ML650 100 µL

CCDC28A, NT (CCDC28A, C6orf80, Coiled-coil domain-containing protein 28A, CCRL1AP) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Gm7866 3'UTR Luciferase Stable Cell Line
TU108607 1.0 mL

Gm7866 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details