Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome c oxidase subunit 2

This Recombinant Cytochrome c oxidase subunit 2 spans the amino acid sequence from region 1-243.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 2, EC= 1.9.3.1, Cytochrome c oxidase polypeptide II

UniProt

P29163

Expression Region

1-243

Origin

Pneumocystis carinii

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNNIIHNDAPTPWGIYFQDGASPVYDGIVELHDQVLFYLLIVLVGVSWILFSTILRFRGS GIVHKYHNHSTTIEFVWTVSPALLLIAIAFPSFKLLYLMDEVIDPSITIKAIGHQWYWSY EYSDYTDKEGQSIEFDSYMLPTEDLEEGQLRQLEVDNRVLVPVNTPLRFIITATDVLHDF AVPSLGIKVDASPGRLNQVSTYVQREGVYYGQCSELCGVLHSSMPIVIEAVSLEKFLSWL DNQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DERL2 Pre-designed siRNA Set A
SI004212A 1 Each

Human DERL2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Kadsuric acid
orb3054238-01 25 mg

Kadsuric acid

Sign In for Pricing
View Details
Kadsuric acid
orb3054238-02 50 mg

Kadsuric acid

Sign In for Pricing
View Details
Kadsuric acid
orb3054238-03 100 mg

Kadsuric acid

Sign In for Pricing
View Details
Kadsuric acid
orb3054238-04 5 mg

Kadsuric acid

Sign In for Pricing
View Details
Adssl1 (NM_007421) Mouse Recombinant Protein
TP524498 20 µg

Adssl1 (NM_007421) Mouse Recombinant Protein

Sign In for Pricing
View Details