Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome c oxidase subunit 2

This Recombinant Cytochrome c oxidase subunit 2 spans the amino acid sequence from region 1-243.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 2, EC= 1.9.3.1, Cytochrome c oxidase polypeptide II

UniProt

P29163

Expression Region

1-243

Origin

Pneumocystis carinii

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNNIIHNDAPTPWGIYFQDGASPVYDGIVELHDQVLFYLLIVLVGVSWILFSTILRFRGS GIVHKYHNHSTTIEFVWTVSPALLLIAIAFPSFKLLYLMDEVIDPSITIKAIGHQWYWSY EYSDYTDKEGQSIEFDSYMLPTEDLEEGQLRQLEVDNRVLVPVNTPLRFIITATDVLHDF AVPSLGIKVDASPGRLNQVSTYVQREGVYYGQCSELCGVLHSSMPIVIEAVSLEKFLSWL DNQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Plant Deoxycytidine Kinase (DCK) ELISA Kit
MBS9374622 Inquire

Plant Deoxycytidine Kinase (DCK) ELISA Kit

Sign In for Pricing
View Details
BC37295_3 antibody
MBS839125 Inquire

BC37295_3 antibody

Sign In for Pricing
View Details
DDX6 siRNA (Mouse)
orb1848282-01 15 nmol

DDX6 siRNA (Mouse)

Sign In for Pricing
View Details
DDX6 siRNA (Mouse)
orb1848282-02 30 nmol

DDX6 siRNA (Mouse)

Sign In for Pricing
View Details
Human GTF2H2C knockdown cell line
ABC-KD6523 1 Vial

Human GTF2H2C knockdown cell line

Sign In for Pricing
View Details
Rat Phosphorylated tau 181 ELISA kit
GTR10452039 96 Well

Rat Phosphorylated tau 181 ELISA kit

Sign In for Pricing
View Details