Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Rv2091c/MT2152 (Rv2091c, MT2152)

This Recombinant Uncharacterized protein Rv2091c/MT2152 (Rv2091c, MT2152) spans the amino acid sequence from region 1-244.

Product Specifications

Product Name Alternative

Uncharacterized protein Rv2091c/MT2152

UniProt

P64939

Expression Region

1-244

Origin

Mycobacterium tuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGPQGSDPRQPWQPPGQGADHSSDPTVAAGYPWQQQPTQEATWQAPAYTPQYQQPADPA YPQQYPQPTPGYAQPEQFGAQPTQLGVPGQYGQYQQPGQYGQPGQYGQPGQYAPPGQYPG QYGPYGQSGQGSKRSVAVIGGVIAVMAVLFIGAVLILGFWAPGFFVTTKLDVIKAQAGVQ QVLTDETTGYGAKNVKDVKCNNGSDPTVKKGATFECTVSIDGTSKRVTVTFQDNKGTYEV GRPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Chd1 activation kit by CRISPRa
GA200712 1 Kit

Mouse Chd1 activation kit by CRISPRa

Sign In for Pricing
View Details
MHC II (HLA-DP) (beta chain) (Bra-14), CF594 conjugate, 0.1mg/mL
BNC941129-100 1x 100 µL

MHC II (HLA-DP) (beta chain) (Bra-14), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SHIP (INPP5D) Rabbit Monoclonal Antibody
TA422280 100 µL

SHIP (INPP5D) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Human ANKRD57 (SOWAHC) activation kit by CRISPRa
GA112244 1 Kit

Human ANKRD57 (SOWAHC) activation kit by CRISPRa

Sign In for Pricing
View Details
2-Fluoroadenine
TRC-F587200-250MG 250 mg

2-Fluoroadenine

Sign In for Pricing
View Details
TentaGel® S NH-NH-Boc
S30137.1G 1 g

TentaGel® S NH-NH-Boc

Sign In for Pricing
View Details