Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Rv2091c/MT2152 (Rv2091c, MT2152)

This Recombinant Uncharacterized protein Rv2091c/MT2152 (Rv2091c, MT2152) spans the amino acid sequence from region 1-244.

Product Specifications

Product Name Alternative

Uncharacterized protein Rv2091c/MT2152

UniProt

P64939

Expression Region

1-244

Origin

Mycobacterium tuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGPQGSDPRQPWQPPGQGADHSSDPTVAAGYPWQQQPTQEATWQAPAYTPQYQQPADPA YPQQYPQPTPGYAQPEQFGAQPTQLGVPGQYGQYQQPGQYGQPGQYGQPGQYAPPGQYPG QYGPYGQSGQGSKRSVAVIGGVIAVMAVLFIGAVLILGFWAPGFFVTTKLDVIKAQAGVQ QVLTDETTGYGAKNVKDVKCNNGSDPTVKKGATFECTVSIDGTSKRVTVTFQDNKGTYEV GRPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alkaline Phosphatase (ALPP) (NM_001632) Human Over-expression Lysate
LC419831 20 µg

Alkaline Phosphatase (ALPP) (NM_001632) Human Over-expression Lysate

Sign In for Pricing
View Details
Human RRP15 activation kit by CRISPRa
GA109501 1 Kit

Human RRP15 activation kit by CRISPRa

Sign In for Pricing
View Details
APOBEC4 Antibody
8C18080-AAT 50 µg

APOBEC4 Antibody

Sign In for Pricing
View Details
Recombinant QKI Monoclonal Antibody
AN301863L-01 50 µL

Recombinant QKI Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant QKI Monoclonal Antibody
AN301863L-02 100 µL

Recombinant QKI Monoclonal Antibody

Sign In for Pricing
View Details
(R)-N-(1-Carboxyethyl)-D-norvaline 1-Ethyl Ester
TRC-C178075-25MG 25 mg

(R)-N-(1-Carboxyethyl)-D-norvaline 1-Ethyl Ester

Sign In for Pricing
View Details