Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Rv2091c/MT2152 (Rv2091c, MT2152)

This Recombinant Uncharacterized protein Rv2091c/MT2152 (Rv2091c, MT2152) spans the amino acid sequence from region 1-244.

Product Specifications

Product Name Alternative

Uncharacterized protein Rv2091c/MT2152

UniProt

P64939

Expression Region

1-244

Origin

Mycobacterium tuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGPQGSDPRQPWQPPGQGADHSSDPTVAAGYPWQQQPTQEATWQAPAYTPQYQQPADPA YPQQYPQPTPGYAQPEQFGAQPTQLGVPGQYGQYQQPGQYGQPGQYGQPGQYAPPGQYPG QYGPYGQSGQGSKRSVAVIGGVIAVMAVLFIGAVLILGFWAPGFFVTTKLDVIKAQAGVQ QVLTDETTGYGAKNVKDVKCNNGSDPTVKKGATFECTVSIDGTSKRVTVTFQDNKGTYEV GRPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Lung
CR559796 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
CLEC4G Antibody
KC-7192-01 50 μL

CLEC4G Antibody

Sign In for Pricing
View Details
CLEC4G Antibody
KC-7192-02 100 µL

CLEC4G Antibody

Sign In for Pricing
View Details
CLEC4G Antibody
KC-7192-03 1 mL

CLEC4G Antibody

Sign In for Pricing
View Details
Slc32a1 Mouse Gene Knockout Kit (CRISPR)
KN516049 1 Kit

Slc32a1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LMCD1 Human Gene Knockout Kit (CRISPR)
KN400062 1 Kit

LMCD1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details