Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Biopolymer transport protein exbB (exbB)

This Recombinant Biopolymer transport protein exbB (exbB) spans the amino acid sequence from region 1-244.

Product Specifications

Product Name Alternative

Biopolymer transport protein exbB

UniProt

P0A1H8

Expression Region

1-244

Origin

Salmonella typhi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGNNLMQTDLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKSVEFFTQKRRLKREQL QLADARSLDQASDIAAGFSAKSLSAQLINEAQNELELSQGSEDNEGIKERTGFRLERRVA AVGRYMGRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLA TAIGLVAAIPAVVIYNIFARQIGSYKATLGDVAAQVLLLQSRDLDLNASASAQPVRAAQK LRVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Renal Artery Smooth Muscle Cells
ARP0702 0.5 Million

Rabbit Renal Artery Smooth Muscle Cells

Sign In for Pricing
View Details
FBXL3 antibody - middle region
MBS3206708-01 0.1 mL

FBXL3 antibody - middle region

Sign In for Pricing
View Details
FBXL3 antibody - middle region
MBS3206708-02 5x 0.1 mL

FBXL3 antibody - middle region

Sign In for Pricing
View Details
TTR Polyclonal Antibody
A55707-020 20 µL

TTR Polyclonal Antibody

Sign In for Pricing
View Details
HS3ST4 Recombinant Protein (Human)
RP063498 100 µg

HS3ST4 Recombinant Protein (Human)

Sign In for Pricing
View Details
Rabbit Actin, Alpha cardiac muscle 1 (ACTC1) ELISA Kit
GTR10368484 96 Well

Rabbit Actin, Alpha cardiac muscle 1 (ACTC1) ELISA Kit

Sign In for Pricing
View Details