Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Biopolymer transport protein exbB (exbB)

This Recombinant Biopolymer transport protein exbB (exbB) spans the amino acid sequence from region 1-244.

Product Specifications

Product Name Alternative

Biopolymer transport protein exbB

UniProt

P0A1H8

Expression Region

1-244

Origin

Salmonella typhi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGNNLMQTDLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKSVEFFTQKRRLKREQL QLADARSLDQASDIAAGFSAKSLSAQLINEAQNELELSQGSEDNEGIKERTGFRLERRVA AVGRYMGRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLA TAIGLVAAIPAVVIYNIFARQIGSYKATLGDVAAQVLLLQSRDLDLNASASAQPVRAAQK LRVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human DNAJC2 shRNA (UAS) - Lentiviral human DNAJC2 shRNA (UAS, RFP) (25)
GTR15326678 1 Vial

Lentiviral human DNAJC2 shRNA (UAS) - Lentiviral human DNAJC2 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
TRIM36 Antibody - middle region : HRP (ARP42989_P050-HRP)
ARP42989_P050-HRP 100 µL

TRIM36 Antibody - middle region : HRP (ARP42989_P050-HRP)

Sign In for Pricing
View Details
Pirenzepine-d11
HY-17037AS 1 Each

Pirenzepine-d11

Sign In for Pricing
View Details
PCDH20 Rabbit pAb, Pacific Blue conjugated
orb2876362 100 µL

PCDH20 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
Tmem30c (NM_027651) Mouse Tagged ORF Clone Lentiviral Particle
MR219036L3V 200 µL

Tmem30c (NM_027651) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PATJ Polyclonal Antibody
E-AB-17933-01 20 µL

PATJ Polyclonal Antibody

Sign In for Pricing
View Details