Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Biopolymer transport protein exbB (exbB)

This Recombinant Biopolymer transport protein exbB (exbB) spans the amino acid sequence from region 1-244.

Product Specifications

Product Name Alternative

Biopolymer transport protein exbB

UniProt

P0ABU8

Expression Region

1-244

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGNNLMQTDLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKSVEFFNQKRRLKREQQ LLAEARSLNQANDIAADFGSKSLSLHLLNEAQNELELSEGSDDNEGIKERTSFRLERRVA AVGRQMGRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLA TAIGLVAAIPAVVIYNVFARQIGGFKAMLGDVAAQVLLLQSRDLDLEASAAAHPVRVAQK LRAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BTG2 Mouse Monoclonal Antibody [Clone ID: LBI4H8]
AMM18245VCF 100 µg

BTG2 Mouse Monoclonal Antibody [Clone ID: LBI4H8]

Sign In for Pricing
View Details
Rat Angiopoietin-like 3 (ANGPTL3) ELISA Kit
AE61784RA-01 48 Tests

Rat Angiopoietin-like 3 (ANGPTL3) ELISA Kit

Sign In for Pricing
View Details
Rat Angiopoietin-like 3 (ANGPTL3) ELISA Kit
AE61784RA-02 96 Tests

Rat Angiopoietin-like 3 (ANGPTL3) ELISA Kit

Sign In for Pricing
View Details
Mouse Alpha 2 HS glycoprotein (AHSG) ELISA Kit
GTR10314150 96 Well

Mouse Alpha 2 HS glycoprotein (AHSG) ELISA Kit

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Transmembrane Protease, Serine 2 (TMPRSS2)
MBS2068269-01 0.1 mL

FITC-Linked Polyclonal Antibody to Transmembrane Protease, Serine 2 (TMPRSS2)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Transmembrane Protease, Serine 2 (TMPRSS2)
MBS2068269-02 0.2 mL

FITC-Linked Polyclonal Antibody to Transmembrane Protease, Serine 2 (TMPRSS2)

Sign In for Pricing
View Details