Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse B-cell receptor-associated protein 31 (Bcap31)

This Recombinant Mouse B-cell receptor-associated protein 31 (Bcap31) spans the amino acid sequence from region 2-245.

Product Specifications

Product Name Alternative

B-cell receptor-associated protein 31, BCR-associated protein 31, Bap31, p28

UniProt

Q61335

Expression Region

2-245

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SLQWTTVATFLYAEVFAVLLLCIPFISPKRWQKVFKSRLVELVVTYGNTFFVVLIVILVL LVIDAVREILKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGLSLLLSFLLRRLVT LISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAEDGDKLDIGNTEMKLEENK SLKNDLRKLKDELASTKKKLEKAENEALAMQKQSEGLTKEYDRLLEEHAKLQASVRGPSV KKEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alizarin
TRC-A536600-500MG 500 mg

Alizarin

Sign In for Pricing
View Details
Human C18orf55 (TIMM21) activation kit by CRISPRa
GA109225 1 Kit

Human C18orf55 (TIMM21) activation kit by CRISPRa

Sign In for Pricing
View Details
IRF5 (NM_001098628) Human Over-expression Lysate
LY420651 100 µg

IRF5 (NM_001098628) Human Over-expression Lysate

Sign In for Pricing
View Details
P Glycoprotein (ABCB1) Mouse Monoclonal Antibody [Clone ID: OTI2H2]
CF809803 100 µg

P Glycoprotein (ABCB1) Mouse Monoclonal Antibody [Clone ID: OTI2H2]

Sign In for Pricing
View Details
Tissue Total RNA, Kidney
CR560629 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details
Human RRBP1 activation kit by CRISPRa
GA104228 1 Kit

Human RRBP1 activation kit by CRISPRa

Sign In for Pricing
View Details