Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse B-cell receptor-associated protein 31 (Bcap31)

This Recombinant Mouse B-cell receptor-associated protein 31 (Bcap31) spans the amino acid sequence from region 2-245.

Product Specifications

Product Name Alternative

B-cell receptor-associated protein 31, BCR-associated protein 31, Bap31, p28

UniProt

Q61335

Expression Region

2-245

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SLQWTTVATFLYAEVFAVLLLCIPFISPKRWQKVFKSRLVELVVTYGNTFFVVLIVILVL LVIDAVREILKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGLSLLLSFLLRRLVT LISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAEDGDKLDIGNTEMKLEENK SLKNDLRKLKDELASTKKKLEKAENEALAMQKQSEGLTKEYDRLLEEHAKLQASVRGPSV KKEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cdr2 Mouse Gene Knockout Kit (CRISPR)
KN503072 1 Kit

Cdr2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NDUF3 (NDUFAF3) (NM_199417) Human Recombinant Protein
TP318529L 1 mg

NDUF3 (NDUFAF3) (NM_199417) Human Recombinant Protein

Sign In for Pricing
View Details
CD71 (TFRC/1059), CF405S conjugate, 0.1mg/mL
BNC041059-500 1x 500 µL

CD71 (TFRC/1059), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prolactin (Pituitary Tumor Marker) (PRL/2644), CF405S conjugate, 0.1mg/mL
BNC042644-500 1x 500 µL

Prolactin (Pituitary Tumor Marker) (PRL/2644), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DYNLRB2 Antibody
8C15517-AAT 50 µg

DYNLRB2 Antibody

Sign In for Pricing
View Details
JIP1 (MAPK8IP1) Mouse Monoclonal Antibody [Clone ID: OTI13F10]
CF809926 100 µg

JIP1 (MAPK8IP1) Mouse Monoclonal Antibody [Clone ID: OTI13F10]

Sign In for Pricing
View Details