Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse B-cell receptor-associated protein 31 (Bcap31)

This Recombinant Mouse B-cell receptor-associated protein 31 (Bcap31) spans the amino acid sequence from region 2-245.

Product Specifications

Product Name Alternative

B-cell receptor-associated protein 31, BCR-associated protein 31, Bap31, p28

UniProt

Q61335

Expression Region

2-245

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SLQWTTVATFLYAEVFAVLLLCIPFISPKRWQKVFKSRLVELVVTYGNTFFVVLIVILVL LVIDAVREILKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGLSLLLSFLLRRLVT LISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAEDGDKLDIGNTEMKLEENK SLKNDLRKLKDELASTKKKLEKAENEALAMQKQSEGLTKEYDRLLEEHAKLQASVRGPSV KKEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn1r202 Mouse Gene Knockout Kit (CRISPR)
KN518995 1 Kit

Vmn1r202 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Mouse CD4/LEU3 Protein (His Tag)
PKSM040318 100 µg

Recombinant Mouse CD4/LEU3 Protein (His Tag)

Sign In for Pricing
View Details
Cytokeratin 17 (KRT17/778), CF647 conjugate, 0.1mg/mL
BNC470778-500 1x 500 µL

Cytokeratin 17 (KRT17/778), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Platelets Mouse Monoclonal Antibody [Clone ID: PP1]
AM26134PU-N 100 µg

Platelets Mouse Monoclonal Antibody [Clone ID: PP1]

Sign In for Pricing
View Details
Texas Red Conjugated Goat Affinity Purified Antibody to Cat IgG Antibody
TAF-421-1 1 mL

Texas Red Conjugated Goat Affinity Purified Antibody to Cat IgG Antibody

Sign In for Pricing
View Details
Recombinant Mouse Frizzled-10/FZD10 Protein (Fc Tag)
PKSM040610 100 µg

Recombinant Mouse Frizzled-10/FZD10 Protein (Fc Tag)

Sign In for Pricing
View Details