Recombinant Poinsettia latent virus Genome-linked protein precursor (ORF2)
This Recombinant Poinsettia latent virus Genome-linked protein precursor (ORF2) spans the amino acid sequence from region 417-660.
Product Specifications
Product Name Alternative
Genome-linked protein precursor, Cleaved into the following 2 chains:, 1. Serine protease, EC= 2. 3.4.21.-, 3. VPg
UniProt
Q5NDN0
Expression Region
417-660
Origin
Poinsettia latent virus (isolate Euphorbia pulcherrima/Germany/Siepen/2005) (PnLV) (Poinsettia cryptic virus)
Field of Research
Infectious Disease & Virology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
TTNVRGNLYNDEGFRLSVGEDDKAEHWTDRLMKSITFKTKRWADWAEEESESDDERGKVV PPAKPSNYGEGCPPEHNQYLSDVGDLLTKVIGPEQNEKCVDILMGIMGVDKNEVAPHKEE KAEKGNEAVVSATVKTVKEPTTQCDEDIISEIVKRVVDKMNLKAIEKSVVEILAEKAMTK APRGKRKNSKDTSRPSTPGSYIIPAKRTPDSGPVEKSLNSTGRAKEESPSGARTLPGNIP AWVR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940745-100 1x 100 µL
CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740352-500 1x 500 µL
CD31 / PECAM-1 (158-2B3), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470745-500 1x 500 µL
CD45 / LCA (2B11 + PD7/26), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680334-500 1x 500 µL
Cytokeratin 8 (H1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details