Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Uncharacterized protein C7orf45 homolog (QtsA-20413)

This Recombinant Macaca fascicularis Uncharacterized protein C7orf45 homolog (QtsA-20413) spans the amino acid sequence from region 1-244.

Product Specifications

Product Name Alternative

Uncharacterized protein C7orf45 homolog

UniProt

Q4R309

Expression Region

1-244

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGDLFSLFWEVDPPPIPLNCAIPNQDYECRKDDSCGTIGNFLLWYFVIVFVLMFFSRASV WMSEDKKDEGSGTSTSVRKASKETSYKWQSKDGAWDPSQTMKKPKQNQLTPVTNSEVALV NAYLEQRRARRQSQFNEVNQNQHDSDTTECGSEESNSEASSWKESESEHHPSPDSIKRRK MAQRQRNLGSYQMSERHCLHCKAMRTNEWLVHHSQQKASVTPPMKGDSPEESSISDINTK FSKF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF568 conjugate, 0.1mg/mL
BNC680322-100 1x 100 µL

CD3e (RIV9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF488A conjugate, 0.1mg/mL
BNC881050-100 1x 100 µL

CD3e (CRIS-7), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF740 conjugate, 0.1mg/mL
BNC740032-100 1x 100 µL

MUC2 (CCP58), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF568 conjugate, 0.1mg/mL
BNC680276-500 1x 500 µL

TAG-72 / CA72.4 (B72.3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-DRB (HLA-DRB/1067), CF405S conjugate, 0.1mg/mL
BNC041067-100 1x 100 µL

HLA-DRB (HLA-DRB/1067), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details