Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Debaryomyces hansenii Altered inheritance of mitochondria protein 36, mitochondrial (AIM36)

This Recombinant Debaryomyces hansenii Altered inheritance of mitochondria protein 36, mitochondrial (AIM36) spans the amino acid sequence from region 36-279.

Product Specifications

Product Name Alternative

Altered inheritance of mitochondria protein 36, mitochondrial, Found in mitochondria protein 39

UniProt

Q6BWY8

Expression Region

36-279

Origin

Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QLYSTKANNEPPKLRFLFYMFIFASGVLYVTGSQIEKKKPKSSFTEKEFEEYESSSGLKR RSKLISTQDAEKYKFFVVPYVHQNEFITKIAQKLGDKEVRIIDPEELIKREREDESRHYS YLLQDLAQEDKPLPKGLVTALIKDDIKFYLNTRNGTFDTNFLIKNYPQTTDEAIKFENDI SDISKCIVLHYDMLNELKKNKGEENARLINNVVGYYETVNKAKIITAKHDELDDKLQEIS LEFI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD4 (EDU-2), CF405S conjugate, 0.1mg/mL
BNC040345-100 1x 100 µL

CD4 (EDU-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF740 conjugate, 0.1mg/mL
BNC740017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF594 conjugate, 0.1mg/mL
BNC940175-100 1x 100 µL

CD46 (122.2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF740 conjugate, 0.1mg/mL
BNC741081-500 1x 500 µL

CD45RO (190-2F2.5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GFAP (GA-5), CF488A conjugate, 0.1mg/mL
BNC880167-500 1x 500 µL

GFAP (GA-5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (57), CF647 conjugate, 0.1mg/mL
BNC470139-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (57), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details