Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L573 (MIMI_L573)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L573 (MIMI_L573) spans the amino acid sequence from region 1-244.

Product Specifications

Product Name Alternative

Uncharacterized protein L573

UniProt

Q5UR99

Expression Region

1-244

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDNTHLIESSLRHQFLTMFRTDNAFIDGILTVMIISLLSYIVKQFSDLPSVIGNIYNKIM IKIRLFFRPKSADKISKTTIIESLSEDKKPNELYTAVYWFLTTNIDLTVDSNVKMSFTKK IELDEYKELKDKNINKNMSYGTKKIFNYTHNNMTFEIEYFFATNLVSVYTDKKRDKENHI IYLTTLIDPNIRFDVFEEFTKMCMREYAKSLVDKKWVQKIFTNNNGRWTETVFITDVNLN SYFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gorasp2 Rat shRNA Lentiviral Particle (Locus ID 113961)
TL700903V 500 µL Each

Gorasp2 Rat shRNA Lentiviral Particle (Locus ID 113961)

Sign In for Pricing
View Details
Human Nuclear Antigen (HNA) (Human Cell Marker) Mouse Monoclonal Antibody
MBS438815-01 0.5 mL

Human Nuclear Antigen (HNA) (Human Cell Marker) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Human Nuclear Antigen (HNA) (Human Cell Marker) Mouse Monoclonal Antibody
MBS438815-02 5x 0.5 mL

Human Nuclear Antigen (HNA) (Human Cell Marker) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal MFSD2B Antibody [DyLight 594]
NBP2-81737DL594 0.1 mL

Rabbit Polyclonal MFSD2B Antibody [DyLight 594]

Sign In for Pricing
View Details
Rabbit Polyclonal UBAP2 Antibody
NBP3-29656 100 µg

Rabbit Polyclonal UBAP2 Antibody

Sign In for Pricing
View Details
Ethyl 6-chloronicotinate 99+% (GC)
237691-01 5 g

Ethyl 6-chloronicotinate 99+% (GC)

Sign In for Pricing
View Details