Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L573 (MIMI_L573)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L573 (MIMI_L573) spans the amino acid sequence from region 1-244.

Product Specifications

Product Name Alternative

Uncharacterized protein L573

UniProt

Q5UR99

Expression Region

1-244

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDNTHLIESSLRHQFLTMFRTDNAFIDGILTVMIISLLSYIVKQFSDLPSVIGNIYNKIM IKIRLFFRPKSADKISKTTIIESLSEDKKPNELYTAVYWFLTTNIDLTVDSNVKMSFTKK IELDEYKELKDKNINKNMSYGTKKIFNYTHNNMTFEIEYFFATNLVSVYTDKKRDKENHI IYLTTLIDPNIRFDVFEEFTKMCMREYAKSLVDKKWVQKIFTNNNGRWTETVFITDVNLN SYFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal BOB1 Antibody (BOB1/2425) - Azide and BSA Free
NBP2-75757 100 µg

Mouse Monoclonal BOB1 Antibody (BOB1/2425) - Azide and BSA Free

Sign In for Pricing
View Details
HTR4 Rabbit pAb
orb2708850-01 50 µL

HTR4 Rabbit pAb

Sign In for Pricing
View Details
HTR4 Rabbit pAb
orb2708850-02 100 µL

HTR4 Rabbit pAb

Sign In for Pricing
View Details
[Lys4]-Antho-RWamide I - FAM Labeled
FG-048-22A 1 nmol

[Lys4]-Antho-RWamide I - FAM Labeled

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) TOC33 Polyclonal Antibody
MBS7181085 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) TOC33 Polyclonal Antibody

Sign In for Pricing
View Details
Lipopolysaccharides
S7850-25mg 25 mg

Lipopolysaccharides

Sign In for Pricing
View Details