Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C7orf45 (C7orf45)

This Recombinant Human Uncharacterized protein C7orf45 (C7orf45) spans the amino acid sequence from region 1-244.

Product Specifications

Product Name Alternative

Uncharacterized protein C7orf45

UniProt

Q8WWF3

Expression Region

1-244

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGDLFSLFWEVDPPPIPVNCAIPNQDYECWKDDSCGTIGSFLLWYFVIVFVLMFFSRASV WMSEDKKDEGSGTSTSVRKASKETSCKRQSKDSAWDPSQTMKKPKQNQLTPVTNSEVALV NAYPEQRRARRQSQFNEVNQNQHDSDTTEYGSEESNSEASSWKESESEHHPSPDSIKRRK MAQRQRNLGSYQMSERHCLHCKALRTNEWLAHHSRQKPSVTPPMKRDSQEESSISDINKK FSKF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Tumor Necrosis Factor Alpha Induced Protein 6 (TNFaIP6) ELISA Kit
RD-TNFaIP6-Mu-01 96 Tests

Mouse Tumor Necrosis Factor Alpha Induced Protein 6 (TNFaIP6) ELISA Kit

Sign In for Pricing
View Details
Mouse Tumor Necrosis Factor Alpha Induced Protein 6 (TNFaIP6) ELISA Kit
RD-TNFaIP6-Mu-02 48 Tests

Mouse Tumor Necrosis Factor Alpha Induced Protein 6 (TNFaIP6) ELISA Kit

Sign In for Pricing
View Details
GRB2 (NM_002086) Human Over-expression Lysate
LY400765 100 µg

GRB2 (NM_002086) Human Over-expression Lysate

Sign In for Pricing
View Details
AATOM™ 550 maleimide
70232-AAT 1 mg

AATOM™ 550 maleimide

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Human CD45RA Antibody[HI100]
E-AB-F1052I-01 20 Tests

PE/Cyanine5.5 Anti-Human CD45RA Antibody[HI100]

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Human CD45RA Antibody[HI100]
E-AB-F1052I-02 100 Tests

PE/Cyanine5.5 Anti-Human CD45RA Antibody[HI100]

Sign In for Pricing
View Details