Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Reticulon-like protein B7 (RTNLB7)

This Recombinant Arabidopsis thaliana Reticulon-like protein B7 (RTNLB7) spans the amino acid sequence from region 1-244.

Product Specifications

Product Name Alternative

Reticulon-like protein B7, AtRTNLB7

UniProt

Q9M145

Expression Region

1-244

Origin

Arabidopsis thaliana (Mouse-ear cress)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEEEKLEIVGPLEEPLMGNIVPEEINGLDSLTSSDSDSEKPDSPVPINAPIYRMFGRERP IHMVLGGGKPADVLLWRDKKVTLGLLSAVTVIWLLFGFGGRRLLTSLCRGSILFLLLSFL WSNALNKSPENMMDIYIPEKPLLQAASAMTFELNCAFATLRSIALERDIKNFVMAVIGLW LVSVIGNWFSFLSLLYICFVLIHTVPMLYEKYEDEIDPIAEKAVIEMKKHYQVFEAKFLS KIPH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF740 conjugate, 0.1mg/mL
BNC741820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF405S conjugate, 0.1mg/mL
BNC040034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF647 conjugate, 0.1mg/mL
BNC470449-500 1x 500 µL

CD104 (UM-A9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF594 conjugate, 0.1mg/mL
BNC940322-100 1x 100 µL

CD3e (RIV9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (MUC1/967), CF405S conjugate, 0.1mg/mL
BNC040967-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (MUC1/967), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGFalpha (MF9), CF568 conjugate, 0.1mg/mL
BNC680644-100 1x 100 µL

TGFalpha (MF9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details