Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Uncharacterized mitochondrial membrane protein FMP10 (FMP10)

This Recombinant Saccharomyces cerevisiae Uncharacterized mitochondrial membrane protein FMP10 (FMP10) spans the amino acid sequence from region 1-244.

Product Specifications

Product Name Alternative

Uncharacterized mitochondrial membrane protein FMP10

UniProt

P40098

Expression Region

1-244

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFKRIAIAQIRTYTNGVVFKTASKPKRRWIPWTIFGGSFLGGWYLTQHMTFTDLLAYWRY DALPKNADEVVKYHADLNRRLNGLPIVKQLENAGFVQVIANEEENLLVSRALNTPGGVAI PPRVYYNPSRRETVGLYHLGMKLTGYPFLIHGGILATVIEDLMKEAIRLEKGTKNINQET KNLSISYKFPTLANQFVVVRTTDLQQYGNKTKLKAELMDQSGNRTLVKANATFSSEQGNP KEEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (B-K9), CF594 conjugate, 0.1mg/mL
BNC940304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF647 conjugate, 0.1mg/mL
BNC470193-100 1x 100 µL

CD86 (BU63), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF594 conjugate, 0.1mg/mL
BNC940225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF594 conjugate, 0.1mg/mL
BNC940096-500 1x 500 µL

Histone H1 (AE-4), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prolactin Receptor (B6.2 + PRLR742), CF488A conjugate, 0.1mg/mL
BNC880744-500 1x 500 µL

Prolactin Receptor (B6.2 + PRLR742), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (C31.3 + C31.7 + C31.10), CF488A conjugate, 0.1mg/mL
BNC881099-500 1x 500 µL

CD31 / PECAM-1 (C31.3 + C31.7 + C31.10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details