Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Porcine transmissible gastroenteritis coronavirus Membrane protein (M)

This Recombinant Porcine transmissible gastroenteritis coronavirus Membrane protein (M) spans the amino acid sequence from region 18-262.

Product Specifications

Product Name Alternative

Membrane protein, M protein, E1 glycoprotein, Matrix glycoprotein, Membrane glycoprotein

UniProt

P09175

Expression Region

18-262

Origin

Porcine transmissible gastroenteritis coronavirus (strain FS772/70) (TGEV)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

RYCAMKDDTGLSCRNSTASACESCFNGGDLIWHLANWNFSWSIILIIFITVLQYGRPQFS WFVYGIKMLIMWLLWPIVLALTIFNAYSEYQVSRYVMFGVSIAGAIVTFVLWIMYFVRSI QLYRRTKSWWSFNPEINAILCVSALGRSYVLPLEGVPTGVTLTLLSGNLYAEGFKIAGGM NIDNLPKYVMVALPSRTIVYTLVGKKLKASSATGWAYYVKSKAGDYSTDARTDNLSEQEK LLHMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (1.4C3), CF640R conjugate, 0.1mg/mL
BNC400149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF405S conjugate, 0.1mg/mL
BNC040149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF594 conjugate, 0.1mg/mL
BNC940160-500 1x 500 µL

CD20 (B9E9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF568 conjugate, 0.1mg/mL
BNC680193-500 1x 500 µL

CD86 (BU63), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF594 conjugate, 0.1mg/mL
BNC941035-100 1x 100 µL

CD8 (C8/1035), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (C81/2885R), CF594 conjugate, 0.1mg/mL
BNC942885-100 1x 100 µL

CD81 / TAPA-1 (C81/2885R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details