Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Treponema pallidum Uncharacterized protein TP_0138 (TP_0138)

This Recombinant Treponema pallidum Uncharacterized protein TP_0138 (TP_0138) spans the amino acid sequence from region 1-245.

Product Specifications

Product Name Alternative

Uncharacterized protein TP_0138

UniProt

O83174

Expression Region

1-245

Origin

Treponema pallidum (strain Nichols)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQPPRPACQDEGTHGKEVCMLLIQKKRLLVVLIVSFLSILFSAGYAFRIGMLHAHKGSAE TILFYGFVAAAFHFILSLYLMLHAHHKKKELLKLADMLRYGGSIGESHFKKFGVLGTQIQ FLLKELLALSAQKSLKIAALSGLQRALTELIPTPVIIIDLNGTILDMTKGARKRVQRADK TLTIEHIFPATDSTRAVQEAEKTHTPVEQEGGIVFIPVFSAVGNISHFLVDISKQPASDE PLSLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDT1 Polyclonal Antibody
E-AB-17785-01 20 µL

CDT1 Polyclonal Antibody

Sign In for Pricing
View Details
CDT1 Polyclonal Antibody
E-AB-17785-02 60 µL

CDT1 Polyclonal Antibody

Sign In for Pricing
View Details
CDT1 Polyclonal Antibody
E-AB-17785-03 120 µL

CDT1 Polyclonal Antibody

Sign In for Pricing
View Details
CDT1 Polyclonal Antibody
E-AB-17785-04 200 µL

CDT1 Polyclonal Antibody

Sign In for Pricing
View Details
(-)-Coclaurine Hydrochloride
TRC-C633550-1MG 1 mg

(-)-Coclaurine Hydrochloride

Sign In for Pricing
View Details
Uncoated Rat GAL3 (Galectin 3) ELISA Kit
E-UNEL-R0063-01 5x 96 Tests

Uncoated Rat GAL3 (Galectin 3) ELISA Kit

Sign In for Pricing
View Details