Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Treponema pallidum Uncharacterized protein TP_0138 (TP_0138)

This Recombinant Treponema pallidum Uncharacterized protein TP_0138 (TP_0138) spans the amino acid sequence from region 1-245.

Product Specifications

Product Name Alternative

Uncharacterized protein TP_0138

UniProt

O83174

Expression Region

1-245

Origin

Treponema pallidum (strain Nichols)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQPPRPACQDEGTHGKEVCMLLIQKKRLLVVLIVSFLSILFSAGYAFRIGMLHAHKGSAE TILFYGFVAAAFHFILSLYLMLHAHHKKKELLKLADMLRYGGSIGESHFKKFGVLGTQIQ FLLKELLALSAQKSLKIAALSGLQRALTELIPTPVIIIDLNGTILDMTKGARKRVQRADK TLTIEHIFPATDSTRAVQEAEKTHTPVEQEGGIVFIPVFSAVGNISHFLVDISKQPASDE PLSLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPS35 Polyclonal Antibody
E-AB-52862-01 20 µL

MRPS35 Polyclonal Antibody

Sign In for Pricing
View Details
MRPS35 Polyclonal Antibody
E-AB-52862-02 60 µL

MRPS35 Polyclonal Antibody

Sign In for Pricing
View Details
MRPS35 Polyclonal Antibody
E-AB-52862-03 120 µL

MRPS35 Polyclonal Antibody

Sign In for Pricing
View Details
MRPS35 Polyclonal Antibody
E-AB-52862-04 200 µL

MRPS35 Polyclonal Antibody

Sign In for Pricing
View Details
Human RAB11FIP4 activation kit by CRISPRa
GA113546 1 Kit

Human RAB11FIP4 activation kit by CRISPRa

Sign In for Pricing
View Details
Phosph-Free Block ELISA Blocking Buffer
6262 100 mL

Phosph-Free Block ELISA Blocking Buffer

Sign In for Pricing
View Details