Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine E3 ubiquitin-protein ligase MARCH2 (41335)

This Recombinant Bovine E3 ubiquitin-protein ligase MARCH2 (41335) spans the amino acid sequence from region 1-245.

Product Specifications

Product Name Alternative

E3 ubiquitin-protein ligase MARCH2, EC= 6.3.2.-, Membrane-associated RING finger protein 2, Membrane-associated RING-CH protein II, MARCH-II

UniProt

Q32L65

Expression Region

1-245

Origin

Bos taurus (Bovine)

Field of Research

Molecular Biology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTGDCCHLPGSLCDCSDSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRALETPSD GPFCRICHEGANGESLLSPCGCSGTLGAVHKSCLERWLSSSNTSYCELCHTEFAVEKRSR SLTEWLKDPGPRTEKRTLCCDVVCFLFITPLAAISGWLCLRGAQDHLRLHSHLEALGLIA LTIALFTIYVLWTLVSFRYHCQLYSEWRRTNQKVRLKMQADGSEGSQHSPLAAGLLKKVA EETPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL
BNC880270-500 1x 500 µL

Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF488A conjugate, 0.1mg/mL
BNC880460-500 1x 500 µL

CD44 Standard (156-3C11), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF740 conjugate, 0.1mg/mL
BNC740096-500 1x 500 µL

Histone H1 (AE-4), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF405S conjugate, 0.1mg/mL
BNC040146-500 1x 500 µL

CD10 (CB-CALLA), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF640R conjugate, 0.1mg/mL
BNC400178-500 1x 500 µL

CD50 (ICAM-3) (186-2G9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF640R conjugate, 0.1mg/mL
BNC400333-100 1x 100 µL

CD8 (RIV11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details