Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Chloride intracellular channel protein 2 (Clic2)

This Recombinant Rat Chloride intracellular channel protein 2 (Clic2) spans the amino acid sequence from region 1-245.

Product Specifications

Product Name Alternative

Chloride intracellular channel protein 2

UniProt

Q5M883

Expression Region

1-245

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASLALNTQADPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTIDTARKPEE LKDLAPGTNPPFLIYNKELKTDFIKIEEFLEKTLAPPRYPHLSPKYKESFDVGCNLFAKF SAYIKNTQKEANKNFEKSLLREFKRLDDYLNTPLLDEIDPDSTEERTLSRRLFLDGDQLT LADCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFAHTCPEDKEIENTYA SVAKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD20 (B9E9), CF740 conjugate, 0.1mg/mL
BNC740160-100 1x 100 µL

CD20 (B9E9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF568 conjugate, 0.1mg/mL
BNC680745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF640R conjugate, 0.1mg/mL
BNC400645-100 1x 100 µL

FOXP3 (3G3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF740 conjugate, 0.1mg/mL
BNC740003-500 1x 500 µL

CD45RO (UCHL-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TLE1 (Synovial Sarcoma Marker) (TLE1/2946R), CF405S conjugate, 0.1mg/mL
BNC042946-500 1x 500 µL

TLE1 (Synovial Sarcoma Marker) (TLE1/2946R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (PHE5), CF488A conjugate, 0.1mg/mL
BNC880461-100 1x 100 µL

Chromogranin A (PHE5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details