Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Expansin-like A1 (EXLA1)

This Recombinant Arabidopsis thaliana Expansin-like A1 (EXLA1) spans the amino acid sequence from region 21-265.

Product Specifications

Product Name Alternative

Expansin-like A1, At-EXPL1, AtEXLA1, AtEXPL1, Ath-ExpBeta-2.1

UniProt

Q9LZT4

Expression Region

21-265

Origin

Arabidopsis thaliana (Mouse-ear cress)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CDRCLHRSKAAYFSSASALSSGACAYGSMATSFFAGHIAAAIPSIYKDGAGCGACFQVRC KNPKLCSTKGTIVMITDLNKSNQTDLVLSSRAFRAMAKPIVGADKDLLKQGIVDIEYQRV PCDYGNKNMNVRVEEASKKPNYLEIKLLYQGGQTEVVSIDIAQVGSSPNWGYMTRSHGAV WVTDKVPTGAIQFRFVVTGGYDGKMIWSQSVLPSNWEAGKIYDAGVQITDIAQEGCDPCD AHIWN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD100 (Semaphorin-4D) (A8), CF640R conjugate, 0.1mg/mL
BNC400218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2037), CF488A conjugate, 0.1mg/mL
BNC882037-100 1x 100 µL

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2037), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pgp9.5 (UCHL-1) (UCHL1/841), CF640R conjugate, 0.1mg/mL
BNC400841-100 1x 100 µL

Pgp9.5 (UCHL-1) (UCHL1/841), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (TP53/1799R), CF640R conjugate, 0.1mg/mL
BNC401799-500 1x 500 µL

P53 Tumor Suppressor Protein (TP53/1799R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (Pituitary Marker) (rCLIP/1407), CF647 conjugate, 0.1mg/mL
BNC472296-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (Pituitary Marker) (rCLIP/1407), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2886R), CF405S conjugate, 0.1mg/mL
BNC042886-100 1x 100 µL

Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2886R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details