Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Canine coronavirus Membrane protein (M)

This Recombinant Canine coronavirus Membrane protein (M) spans the amino acid sequence from region 18-262.

Product Specifications

Product Name Alternative

Membrane protein, M protein, E1 glycoprotein, Matrix glycoprotein, Membrane glycoprotein

UniProt

P36299

Expression Region

18-262

Origin

Canine coronavirus (strain Insavc-1) (CCoV) (Canine enteric coronavirus)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ERYCAMTESSTSCRNSTAGNCASCFETGDLIWHLANWNFSWSVILIIFITVLQYGRPQFS WFVCGIKMLIMWLLWPIVLALTIFNAYLEYRVSRYVMFGFSVAGATVTFILWIMYFVRSI QLYRRTKSWWSFNPETSAILCVSALGRSYVLPLEGVPTGVTLTLLSGNLCAEGFKIAGGM NIDNLPKYVMVALPVRTIVYTLVGKKLKASSATGWAYYVKSKAGDYSTDARTDNLSEHEK LLHMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Gamma-Endorphin (gEP) CLIA Kit
abx490477-01 96 Tests

Human Gamma-Endorphin (gEP) CLIA Kit

Sign In for Pricing
View Details
Human Gamma-Endorphin (gEP) CLIA Kit
abx490477-02 5x 96 Tests

Human Gamma-Endorphin (gEP) CLIA Kit

Sign In for Pricing
View Details
Human Gamma-Endorphin (gEP) CLIA Kit
abx490477-03 10x 96 Tests

Human Gamma-Endorphin (gEP) CLIA Kit

Sign In for Pricing
View Details
Add2 siRNA Oligos set (Rat)
11404176 3x 5 nmol

Add2 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Uncharacterized protein ypzH (ypzH)
MBS1223679-01 0.02 mg (E-Coli)

Recombinant Bacillus subtilis Uncharacterized protein ypzH (ypzH)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Uncharacterized protein ypzH (ypzH)
MBS1223679-02 0.1 mg (E-Coli)

Recombinant Bacillus subtilis Uncharacterized protein ypzH (ypzH)

Sign In for Pricing
View Details