Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Canine coronavirus Membrane protein (M)

This Recombinant Canine coronavirus Membrane protein (M) spans the amino acid sequence from region 18-262.

Product Specifications

Product Name Alternative

Membrane protein, M protein, E1 glycoprotein, Matrix glycoprotein, Membrane glycoprotein

UniProt

P36299

Expression Region

18-262

Origin

Canine coronavirus (strain Insavc-1) (CCoV) (Canine enteric coronavirus)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ERYCAMTESSTSCRNSTAGNCASCFETGDLIWHLANWNFSWSVILIIFITVLQYGRPQFS WFVCGIKMLIMWLLWPIVLALTIFNAYLEYRVSRYVMFGFSVAGATVTFILWIMYFVRSI QLYRRTKSWWSFNPETSAILCVSALGRSYVLPLEGVPTGVTLTLLSGNLCAEGFKIAGGM NIDNLPKYVMVALPVRTIVYTLVGKKLKASSATGWAYYVKSKAGDYSTDARTDNLSEHEK LLHMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Phospholipase A2, Lipoprotein Associated (LpPLA2) ELISA Kit
RDR-LpPLA2-Ra-48Tests 48 Tests

Rat Phospholipase A2, Lipoprotein Associated (LpPLA2) ELISA Kit

Sign In for Pricing
View Details
Caspr (CNTNAP1) Human Gene Knockout Kit (CRISPR)
KN418019 1 Kit

Caspr (CNTNAP1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TUBA8 AAV Vector (Human) (CMV)
48802101 1 µg

TUBA8 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Rab27a Rabbit Polyclonal Antibody (BF594)
orb2504325 100 µL

Rab27a Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
GFAP-RFP (Puro) Lentivirus
LVP1126-P-PBS 1x 10^8 IFU/mL - 200 μL

GFAP-RFP (Puro) Lentivirus

Sign In for Pricing
View Details
Recombinant Mouse Death Receptor 6/DR6/TNFRSF21/CD358 (C-Fc-6His)
32-9725-500 500 µg

Recombinant Mouse Death Receptor 6/DR6/TNFRSF21/CD358 (C-Fc-6His)

Sign In for Pricing
View Details