Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse E3 ubiquitin-protein ligase MARCH2 (41335)

This Recombinant Mouse E3 ubiquitin-protein ligase MARCH2 (41335) spans the amino acid sequence from region 1-246.

Product Specifications

Product Name Alternative

E3 ubiquitin-protein ligase MARCH2, EC= 6.3.2.-, Membrane-associated RING finger protein 2, Membrane-associated RING-CH protein II, MARCH-II

UniProt

Q99M02

Expression Region

1-246

Origin

Mus musculus (Mouse)

Field of Research

Molecular Biology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTGDCCHLPGSLCDCSSSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRALDSQSD CPFCRICHEGANGENLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPR PLTEWLKDPGPRTEKRTLCCDMVCFVFITPLAAISGWLCLRGAQDHLRLHSRLEAVGLIA LTIALFTIYVLWTLVSFRYHCQLYSEWRKTNQKVRLKIREADGSEDPHHSLLATGLLKKV AEETPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MART-1 / Melan-A (M2-7C10), CF740 conjugate, 0.1mg/mL
BNC740009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF640R conjugate, 0.1mg/mL
BNC400977-500 1x 500 µL

TGF-beta (1D11.16.8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF568 conjugate, 0.1mg/mL
BNC680003-100 1x 100 µL

CD45RO (UCHL-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF405S conjugate, 0.1mg/mL
BNC040342-100 1x 100 µL

CD43 (84-3C1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RB (B-Cell Marker) (PTPRC/2877R), CF488A conjugate, 0.1mg/mL
BNC882877-500 1x 500 µL

CD45RB (B-Cell Marker) (PTPRC/2877R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2959), CF740 conjugate, 0.1mg/mL
BNC742959-100 1x 100 µL

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2959), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details