Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Transmembrane protein 33 (Tmem33)

This Recombinant Rat Transmembrane protein 33 (Tmem33) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Transmembrane protein 33, Protein DB83

UniProt

Q9Z142

Expression Region

1-247

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADTTPNGPQGAGAVQFMMTNKLDTAMWLSRLFTVYCSALFVLPLLGLHEAASFYQRALL ANALTSALRLHQRLPHFQLSRAFLAQALLEDSCHYLLYSLIFVNSYPVTMSIFPVLLFSL LHAATYTKKVLDAKGSNSLPLLRSVLDKLSTNQQNILKFIACNEIFLMPATVFMLFSGQG SLLQPFIYYRFLTLRYSSRRNPYCRNLFNELRIVVEHIIMKPSCPLFVRRLCLQSIAFIS RLAPTVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-(4-Benzyloxyphenyl)nicotinic acid
TRC-B288923-250MG 250 mg

5-(4-Benzyloxyphenyl)nicotinic acid

Sign In for Pricing
View Details
Prostate Specific Antigen Antibody
KC-355-01 50 μL

Prostate Specific Antigen Antibody

Sign In for Pricing
View Details
Prostate Specific Antigen Antibody
KC-355-02 100 µL

Prostate Specific Antigen Antibody

Sign In for Pricing
View Details
Prostate Specific Antigen Antibody
KC-355-03 1 mL

Prostate Specific Antigen Antibody

Sign In for Pricing
View Details
Slc24a2 Mouse Gene Knockout Kit (CRISPR)
KN515950 1 Kit

Slc24a2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
STRBP Rabbit Polyclonal Antibody
TA382153 100 µL

STRBP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details