Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Transmembrane protein 33 (Tmem33)

This Recombinant Rat Transmembrane protein 33 (Tmem33) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Transmembrane protein 33, Protein DB83

UniProt

Q9Z142

Expression Region

1-247

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADTTPNGPQGAGAVQFMMTNKLDTAMWLSRLFTVYCSALFVLPLLGLHEAASFYQRALL ANALTSALRLHQRLPHFQLSRAFLAQALLEDSCHYLLYSLIFVNSYPVTMSIFPVLLFSL LHAATYTKKVLDAKGSNSLPLLRSVLDKLSTNQQNILKFIACNEIFLMPATVFMLFSGQG SLLQPFIYYRFLTLRYSSRRNPYCRNLFNELRIVVEHIIMKPSCPLFVRRLCLQSIAFIS RLAPTVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MDR-1 Human Recombinant Protein, Synthetic Nanodisc
TP721401M 100 µg

MDR-1 Human Recombinant Protein, Synthetic Nanodisc

Sign In for Pricing
View Details
Cyclin D1 (G1-Cyclin & Mantle Cell Lymphoma Marker) (CCND1/3548), Biotin conjugate, 0.1mg/mL
BNCB3548-100 1x 100 µL

Cyclin D1 (G1-Cyclin & Mantle Cell Lymphoma Marker) (CCND1/3548), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EIF4A1 (NM_001416) Human Over-expression Lysate
LY400547 100 µg

EIF4A1 (NM_001416) Human Over-expression Lysate

Sign In for Pricing
View Details
PSMG2 Mouse Monoclonal Antibody [Clone ID: OTI2E12]
CF808202 100 µg

PSMG2 Mouse Monoclonal Antibody [Clone ID: OTI2E12]

Sign In for Pricing
View Details
OR4E2 Antibody
8G597-AAT 50 µg

OR4E2 Antibody

Sign In for Pricing
View Details
1,2-Dibromo-4-(3-bromophenoxy)benzene
TRC-D422895-50MG 50 mg

1,2-Dibromo-4-(3-bromophenoxy)benzene

Sign In for Pricing
View Details