Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Peroxisomal membrane protein 11A (PEX11A)

This Recombinant Bovine Peroxisomal membrane protein 11A (PEX11A) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Peroxisomal membrane protein 11A, Peroxin-11A, Peroxisomal biogenesis factor 11A

UniProt

Q0VCP2

Expression Region

1-247

Origin

Bos taurus (Bovine)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDAFIRFTNQTQGRDRLFRATQYTCMLLRYLLEPKADNEKVVMKLKKLESSVSTGRKWFR LGNVVHALQATQQSVRATDLVPRICLTLASLNRVIYFICDTVLFVRSTGLASGVNKEKWR RWAARYYYYSLLLSLVRDLYEVSLQMKQVAHDRAKREKSPSQDTLGYSVADEETEWLQSL LLLLFHSLKRHPPLFLDTVKNFCDILNPLDQLGIYKSNPGIIGLGGLVSSVAGIITVAYP QMKLKTQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL
BNC880050-500 1x 500 µL

IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF405S conjugate, 0.1mg/mL
BNC040039-100 1x 100 µL

CD34 (ICO-115), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF647 conjugate, 0.1mg/mL
BNC470345-500 1x 500 µL

CD4 (EDU-2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF594 conjugate, 0.1mg/mL
BNC941050-500 1x 500 µL

CD3e (CRIS-7), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HER-2 / c-erbB-2 / neu / CD340 (ERBB2/2453), CF640R conjugate, 0.1mg/mL
BNC402453-500 1x 500 µL

HER-2 / c-erbB-2 / neu / CD340 (ERBB2/2453), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF740 conjugate, 0.1mg/mL
BNC741045-100 1x 100 µL

CD16 (C16/1045), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details