Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized FAM18-like protein C34D4.4 (C34D4.4)

This Recombinant Uncharacterized FAM18-like protein C34D4.4 (C34D4.4) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Uncharacterized FAM18-like protein C34D4.4

UniProt

Q18449

Expression Region

1-247

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRTKAKISGAFPREKYGMQVRNRRKVCKQHTSRANSSTFPTKMSGFENDISIGATMTQSQ TSQGFSLQMFGKPTIVLAHLSFKGAALFFYFFANFFTNSFIVQFLVILTLLSMDFWTVKN ITGRLLVGLRWWNFVDADGNNHWKFESAKDMTRFATIDRRVFWLGLVVGPAAWIFFVVTA FLTLKFEWMIVALLGALMNMANLWGYLRCRWNNTEQMTSYFQKWAFLNVLRRAQQPPQEY QNPVFSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP3 (3G3), CF488A conjugate, 0.1mg/mL
BNC880645-100 1x 100 µL

FOXP3 (3G3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL
BNC880270-500 1x 500 µL

Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF647 conjugate, 0.1mg/mL
BNC470175-100 1x 100 µL

CD46 (122.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BOB.1 (B-Cell Marker) (BOB1/2422), CF568 conjugate, 0.1mg/mL
BNC682422-100 1x 100 µL

BOB.1 (B-Cell Marker) (BOB1/2422), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1731R), CF740 conjugate, 0.1mg/mL
BNC741731-500 1x 500 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1731R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (Macrophage Marker) (C68/2501), CF514 conjugate, 0.1mg/mL
BNC142501-500 1x 500 µL

CD68 (Macrophage Marker) (C68/2501), CF514 conjugate, 0.1mg/mL

Sign In for Pricing
View Details