Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Abhydrolase domain-containing protein 14A (Abhd14a)

This Recombinant Mouse Abhydrolase domain-containing protein 14A (Abhd14a) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Abhydrolase domain-containing protein 14A, EC= 3.-.-.-, Down-regulated in Zic-1-mutant protein

UniProt

Q922Q6

Expression Region

1-247

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVQKFMSRYQAALLGLGLLLVFLLYMGLPGPPEQTSRLWRGPNVTVLTGLTRGNSRIFYR EVLPIQQACRAEVVFLHGKAFNSHTWEQLGTLQLLSERGYRAVAIDLPGFGNSAPSEEVS TEAGRVELLERVFQDLQVQNTVLVSPSLSGSYALPFLMQNHHQLRGFVPIAPTYTRNYAQ EQFRAVKTPTLILYGELDHTLARESLQQLRHLPNHSMVKLRDAGHACYLHKPEAFHLALL AFLDHLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOAT 2 (SOAT2) Human Gene Knockout Kit (CRISPR)
KN421499 1 Kit

SOAT 2 (SOAT2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Adracalin (AAAS) Human Gene Knockout Kit (CRISPR)
KN400154 1 Kit

Adracalin (AAAS) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ent-Olutasidenib
TRC-O299820-100MG 100 mg

Ent-Olutasidenib

Sign In for Pricing
View Details
Bodi Fluor FL-C12 [equivalent to BODIPY™ FL C12]
22121-AAT 1 mg

Bodi Fluor FL-C12 [equivalent to BODIPY™ FL C12]

Sign In for Pricing
View Details
FLJ40182 Human qPCR Primer Pair (NM_173696)
HP218474 200 Reactions

FLJ40182 Human qPCR Primer Pair (NM_173696)

Sign In for Pricing
View Details
Benchtop High Speed Centrifuge BCBH-305
BCBH-305 1 Unit

Benchtop High Speed Centrifuge BCBH-305

Sign In for Pricing
View Details