Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative tetraspanin-19 (TSPAN19)

This Recombinant Human Putative tetraspanin-19 (TSPAN19) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

Putative tetraspanin-19, Tspan-19

UniProt

P0C672

Expression Region

1-248

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLRNNKTIIIKYFLNLINGAFLVLGLLFMGFGAWLLLDRNNFLTAFDENNHFIVPISQIL IGMGSSTVLFCLLGYIGIHNEIRWLLIVYAVLITWTFAVQVVLSAFIITKKEEVQQLWHD KIDFVISEYGSKDKPEDITKWTILNALQKTLQCCGQHNYTDWIKNKNKENSGQVPCSCTK STLRKWFCDEPLNATYLEGCENKISAWYNVNVLTLIGINFGLLTSEVFQVSLTVCFFKNI KNIIHAEM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5,7-Dichloro-8-Quinolinol Glucuronide
TRC-D436300-10MG 10 mg

5,7-Dichloro-8-Quinolinol Glucuronide

Sign In for Pricing
View Details
HEAB (CLP1) (NM_006831) Human Over-expression Lysate
LY402047 100 µg

HEAB (CLP1) (NM_006831) Human Over-expression Lysate

Sign In for Pricing
View Details
C2orf43 (LDAH) (NM_001282719) Human Tagged ORF Clone
RG237167 10 µg

C2orf43 (LDAH) (NM_001282719) Human Tagged ORF Clone

Sign In for Pricing
View Details
ERI3 (NM_001301700) Human Tagged ORF Clone
RG236587 10 µg

ERI3 (NM_001301700) Human Tagged ORF Clone

Sign In for Pricing
View Details
CD268 / BAFFR / TNFRSF13C (BAFFR/1557), CF640R conjugate, 0.1mg/mL
BNC401557-100 1x 100 µL

CD268 / BAFFR / TNFRSF13C (BAFFR/1557), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thiamine Sulfate
TRC-T344085-100MG 100 mg

Thiamine Sulfate

Sign In for Pricing
View Details